PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_2AS_1161E1D2E.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 778aa    MW: 85016.5 Da    PI: 5.147
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_2AS_1161E1D2E.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding36.98.5e-1279120648
                            HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding   6 teEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                            +eEd+ l   ++ +G+++W+ Ia  +   +t+ qc+ rw++yl
  Traes_2AS_1161E1D2E.2  79 PEEDDVLRAQIAHHGTDNWTVIATQFK-DKTARQCRRRWYNYL 120
                            8*************************9.**************7 PP

2Myb_DNA-binding41.14.2e-13126169146
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                            +g W+ eEd ll +a k+lG++ W+ Ia+ +  gRt++ +k+r+ +
  Traes_2AS_1161E1D2E.2 126 KGGWSREEDMLLCEAQKLLGNK-WTEIAKVVS-GRTDNAVKNRFST 169
                            688*******************.*********.**********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.14970120IPR017930Myb domain
SMARTSM007173.5E-873122IPR001005SANT/Myb domain
PfamPF139212.8E-1379137No hitNo description
CDDcd001671.17E-1079120No hitNo description
Gene3DG3DSA:1.10.10.606.8E-1879127IPR009057Homeodomain-like
SuperFamilySSF466894.49E-24100178IPR009057Homeodomain-like
PROSITE profilePS5129419.499121175IPR017930Myb domain
SMARTSM007171.3E-13125173IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.0E-19128174IPR009057Homeodomain-like
CDDcd001671.30E-9129170No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 778 aa     Download sequence    Send to blast
SSPALQFENS HPRAQTPNPS RSGPAQPPLR PAGPARGTCG IWAHGDRPRS DLLLRRRRRR  60
RRRLVGGQEG PPHRQLERPE EDDVLRAQIA HHGTDNWTVI ATQFKDKTAR QCRRRWYNYL  120
NTECKKGGWS REEDMLLCEA QKLLGNKWTE IAKVVSGRTD NAVKNRFSTL CKRRAKDDEL  180
FEENGTVCSN ASAKRVLTQS GGVTCAAPGS SPPIKNMSSC KPDFKENIAP NMKSFAQQKS  240
IQQDSRQPLA SICPDNQSVN IVKTQSLVTK TSTKQLHGEE QSCVKHEGNF LKRNDPKLAT  300
LLQQADLLSS LATKVNTENT SQSMDEAWQK LQHHLVKKDD NDMSESSMSG TASLLDDLDD  360
LIVDPYENEE EDEQKSREQN GATSQMAPDQ IMDNCPVDQI AEESSLCGNT LSSTMEPCPV  420
AEILAHINLG EAAEDMGLHF MEYSSPTRAA QAQQAKADAE IPASVDLSES AEVQAEQAKA  480
DAEIPVSVDL SEAAEGSWSQ FMEYTSPAHT VLHAEGDAET PASVKLREAA EGSLPQCMEH  540
MSPAHTLLRA KRDSEIPASA NSNEAAEGSW SQFMEYMSPA HIVLHAKADA ETPASVNLGE  600
AAEGSLPQCM EPMSPAHTLL RAKTDYEIPA SANLSEAAKY DSLQCTECTS PARADLQAKA  660
DEEISENFSE VAQDSRLQCA KFTSLAHTAS KGKAVAKKGT SENCSDVPED SSTQPCMEFT  720
SPAHTVPTFH PFTDNVPTPK ITASERNFLL SVLELASPGS KPETSQQPSC KRALLNSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-278017413107B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15462RRRRRRRRR
25562RRRRRRRR
35662RRRRRRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF9519130.0JF951913.1 Triticum carthlicum clone TaMYB30 R2R3-MYB protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010235205.10.0PREDICTED: uncharacterized protein LOC100835080 isoform X1
TrEMBLW5AZK40.0W5AZK4_WHEAT; Uncharacterized protein
STRINGMLOC_9840.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP89033847
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02820.15e-65myb domain protein 88
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]